PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G06590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 27554.9 Da    PI: 4.9029
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G06590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.86.9e-243683350
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     ie++  rqvtf+kR ng+lKKA+ELS L daeva+i+fss+g+lyey 
  OBART05G06590.1 36 IEDTADRQVTFCKRCNGLLKKAYELSMLYDAEVALIVFSSRGRLYEYN 83
                     99*********************************************6 PP

2K-box48.44.1e-171011954100
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLsl.keLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      s+ + ++e +a+++qqe+akLk+ i  Lq+++R ++  +L+ L++  +L ++  +L  +l+kiR++Knell+++ie++q++e elq++n++ ++
  OBART05G06590.1 101 SNASTVAEINAQHYQQEAAKLKQHITYLQNSNRFII--SLSCLDFfFQLDKVV-HLVIGLEKIRARKNELLCAEIEYMQRRETELQNDNMYSKS 191
                      44444999**********************977765..788777524666664.5889********************************9999 PP

            K-box  97 klee 100
                      +++e
  OBART05G06590.1 192 EVAE 195
                      8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-192685IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.7082686IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-202848IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.55E-213697IPR002100Transcription factor, MADS-box
PfamPF003191.4E-223682IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-204863IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-206384IPR002100Transcription factor, MADS-box
PfamPF014864.3E-10110188IPR002487Transcription factor, K-box
PROSITE profilePS512978.053111199IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGS SDGSGIEDTA DRQVTFCKRC NGLLKKAYEL  60
SMLYDAEVAL IVFSSRGRLY EYNNSVEETI ERYKKANSDT SNASTVAEIN AQHYQQEAAK  120
LKQHITYLQN SNRFIISLSC LDFFFQLDKV VHLVIGLEKI RARKNELLCA EIEYMQRRET  180
ELQNDNMYSK SEVAESERGL QTVNMIGSAS TSEYVQNMIH YDPRNFQQFN IMQQLASESL  240
GTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321571e-115AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankAK1117231e-115AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
GenBankFJ7509421e-115FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.11e-120PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-124MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0D3G4B30.0A0A0D3G4B3_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g11414.11e-121(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-63MIKC_MADS family protein